PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G181800.1
Common NameB456_008G181800, LOC105762499
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 93aa    MW: 10354.7 Da    PI: 10.1049
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G181800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH231.4e-0720591554
                        HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                        +i +  ++L++l+P++ + +  K+s + +L+++++YI+sL
  Gorai.008G181800.1 20 QIIDLVSKLQQLIPELRGRRPDKVSASKVLQETCNYIRSL 59
                        5667779********8677777888899**********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.442559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.7E-81973IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.0E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.01E-82076IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGASRITDDQ IIDLVSKLQQ LIPELRGRRP DKVSASKVLQ ETCNYIRSLH  60
REVDGLSDRL SQLLASTDTD SDQAAIIRSL LM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435728.13e-58PREDICTED: transcription factor PRE6-like
SwissprotQ9LJX17e-41PRE5_ARATH; Transcription factor PRE5
TrEMBLA0A0D2U5B03e-58A0A0D2U5B0_G
STRINGVIT_01s0026g02030.t019e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.19e-39bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]